PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.29F4X
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 98aa    MW: 11431.1 Da    PI: 10.2439
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.29F4XgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding431.1e-131458145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +g W++ Ede+l++ + ++G g+W+++++  g+ R+ k+c++r +
      Aradu.29F4X 14 KGLWSPKEDEKLLRHIIKYGHGCWSSVPKQAGLQRCSKSCRLRCN 58
                     678***************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.41E-12757IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-18759IPR009057Homeodomain-like
PROSITE profilePS5129412.768963IPR017930Myb domain
SMARTSM007174.0E-61363IPR001005SANT/Myb domain
PfamPF002493.0E-121459IPR001005SANT/Myb domain
CDDcd001678.71E-91759No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MGRHSYCYKQ KLWKGLWSPK EDEKLLRHII KYGHGCWSSV PKQAGLQRCS KSCRLRCNMS  60
HSVAKQNAST SEFRYHSLKN CAQVNGYETR ILSTSEHR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008800337.18e-30PREDICTED: transcription factor MYB86, partial
RefseqXP_012490265.12e-29PREDICTED: transcription factor MYB86
RefseqXP_013469134.11e-29myb transcription factor MYB64
SwissprotQ8LPH64e-27MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A072VMV61e-29A0A072VMV6_MEDTR; Myb transcription factor MYB64
TrEMBLA0A0D2SIE12e-29A0A0D2SIE1_G
TrEMBLQ0PJD44e-30Q0PJD4_SOYBN; MYB transcription factor MYB64 (Fragment)
STRINGPOPTR_0014s10680.11e-28(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.36e-32myb domain protein 55